Fibroblast Growth Factor (basic)

Fibroblast Growth Factor (basic), Human Recombinant
Cell Culture Reagents-Growth Supplements


Catalogue Number: CC107
Description: FGF-basic is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described. The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. Fibroblast Growth Factor-2 Human Recombinant (FGF-2) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 147 amino acids and having a molecular mass of 16539 Dalton. The FGF2 is purified by proprietary chromatographic techniques.
Source: Escherichia Coli.
Physical Appearance: Sterile Filtered Clear Solution.
Formulation: 100g/ml solution in 10mM sodium phosphate buffer (pH=8.0) with 0.1% BSA added as stabilizer.
Stability: bFGF should be stored at 4°C between 2-7 days and for future use below -20°C. Please avoid freeze-thaw cycles.
Suitability: Cell culture tested
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Biological Activity: The ED50, measured in a mitogenic assay using quiescent NR6R-3T3 fibroblasts was found to be less then 0.1ng/ml, corresponding to a specific activity of 3 x 106units/mg.
Amino acid sequence:
MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Catalogue Number        Description        Protein Conc.        Pack Size
CC107-1UG        bFGF        10 ug/mL        100 uL
CC107-10UG        bFGF        10 ug/mL        1 mL